ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 9(PCR9)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:P0CW98
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSEQEGKNEKKVTEGQWTTGLYDCLSEDISTCCFTWVCPCVAFGRIAEILDKGETSRGLA GLMVVAMSSIGCGWYYASKYRAKLRHQYALPEAPCADGAIHCFCCPCALTQEHRELKHRG LDPSLGWNIENGGLNSNTPPFVASGMDR
Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 9 Short name= AtPCR9
Gene Names:Name:PCR9 Ordered Locus Names:At1g58320 ORF Names:F19C14.14
Expression Region:1-148
Sequence Info:fµLl length protein
This content will be shared across all product pages.