Skip to Content

ELISA Recombinant Caenorhabditis briggsae Golgi SNAP receptor complex member 1(gos-28)

https://www.crysalin.com/web/image/product.template/121149/image_1920?unique=45d657d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Caenorhabditis briggsae Uniprot NO.:A8XLW0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSETWEALRKKARSTENSIDVKLVSLNKLTASSHGGFDIDEKTVSSRQTTFRTVTTEIEGLIEQLTNINDDMNDVAGAQSSASWASNPAIQHTLRRHREILRDYGSEYRRARDNVDQVLQRELLLSSSNNESRNPAVNNRARGYDMYLKENDHINACDRLLDEQIEMAMSTKENVARQGINLRGISNRLHYITKKYPAINNLMQKIKTKKQKNTMILAGVISACLIFTIFWIIN Protein Names:Recommended name: Golgi SNAP receptor complex member 1 Alternative name(s): 28 kDa Golgi SNARE protein Short name= GOS-28 Gene Names:Name:gos-28 Synonyms:gosr-1, gs28 ORF Names:CBG15298 Expression Region:1-234 Sequence Info:fµLl length protein

1,582.00 € 1582.0 EUR 1,582.00 € Tax Excluded

1,582.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days